DPCstruct | MC56382
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 140 ± 11 aa |
| Standard deviation of domain lengths | 11.16 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 22.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q6DM00 | 70-208 | RSFLKEFKLKNKDRSYEATGSGNGGDPMAADFVNQARSAISGCGIEKALRIEHPSKFREFNRRFYKVRIRTVAFNLCVDDSSNCDFN… |
| A0A1Z3NBC7 | 1-138 | MKFILTLLMTLGASTHASPLQDGQETNGGDPYAAEFLFVVDSTLQQLPLTLPLENEAAIQREVLEEARTAVLVASVEVLNLDGREVA… |
| A0A254QBD8 | 8-139 | None |
| A0A2M6X5S5 | 20-166 | None |
| K7YKY1 | 1-143 | None |
| A0A2E4DA39 | 2-138 | None |
| A0A4Q6EXU8 | 1-140 | None |
| A0A4Q6EU33 | 7-142 | None |
| A0A150WQT8 | 1-147 | None |
| A0A150WMU4 | 1-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.