DPCstruct | MC56374
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 171 ± 32 aa |
| Standard deviation of domain lengths | 32.27 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 74.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 24.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0L4M6 | 6-184 | TEAPSLEGAAAGRVGEQVRPLEVPIVILAHKWDCFEADFGSSDLRKLATRVLRFMAHQHGASLVCSKHKDKASMSVVRNLLCHHVFG… |
| A0A2G9T3S9 | 1-110 | MTDQQADRILVQVRRLCLQLGAALIYTSAKNVKNIQVLYKYVVHRAFGFPFTSTAQLIERDSVFVPAGWDGEKKIEIVKEGLPDADG… |
| A0A2H2JIN7 | 4-167 | None |
| A0A2A2KD69 | 594-778 | None |
| A0A388L886 | 562-732 | None |
| A0A814WCB8 | 291-465 | None |
| U6L3K7 | 14-171 | None |
| A0A1X7TLR3 | 9-192 | None |
| A0A1X7T9S7 | 59-192 | None |
| A0A7R8H6C2 | 258-432 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.