DPCstruct | MC56373
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 139 ± 6 aa |
| Standard deviation of domain lengths | 5.57 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 88.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 39.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P4WVV6 | 171-308 | SALPPASERISRAITRVHDAVLAHFDEVCEEDQHILFTLIEEHLPPKLRELALDRVQQNVPLAYIRSIVASSLASKIVYREGLQFTE… |
| A0A7S0L3K0 | 1-133 | AINKVTDAITDALENVQPEDPLFKELFPLIKEGLPAKMVEIGGDRIGNNFPVQYQRNAIASALASKLVYKEGIHLVEIQPADQIADR… |
| A0A7S4DUQ9 | 54-192 | None |
| A0A6T8JGL8 | 13-141 | None |
| A0A2P4XTI4 | 171-304 | None |
| A0A7R9WHY9 | 128-270 | None |
| A0A7S2BCL8 | 229-374 | None |
| A0A7S4IDD4 | 811-951 | None |
| A0A7S4HYH1 | 86-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.