DPCstruct | MC5637
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 135 ± 23 aa |
| Standard deviation of domain lengths | 22.53 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.68 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | CL0317- CL0421 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G2WCQ1 | 3-113 | RGIPIDQEASPLPMARVENFDQRRPVNYEMQPPTIPHAIDNYQLTVNTNRCMLCHTRSNAAKFQAPPVSPAHYVTRDGQVLEQISTR… |
| A0A6H0T5E4 | 14-136 | GLAFANPTVEKVPSTIEEGVESVAPAFHNMPKDTGKIGISFVNQPPMIPHSVKGYQVTKNTNQCLSCHGIEHYQTTGAPRISPTHFQ… |
| A0A8A3N8Q7 | 22-157 | None |
| A0A7C3L4M1 | 47-229 | None |
| A0A7V2T585 | 4-123 | None |
| A0A5C8BTI0 | 39-184 | None |
| A0A483A7D3 | 58-190 | None |
| A0A7Y8L7S9 | 29-166 | None |
| A0A1G1HT26 | 18-149 | None |
| A0A7V1K4K8 | 2-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.