DPCstruct | MC56366
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 42 ± 2 aa |
| Standard deviation of domain lengths | 1.80 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 91.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 74.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0694 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C6I7D1 | 618-656 | METSKWISGTYYVKADGTMAISEWVDGGKYYVGSDGKWI |
| R5P6W1 | 650-690 | MQTSKWIDGTYYVQADGTMAVSKWVDGGKYYVGSDGKWIKN |
| X8H8J8 | 321-362 | None |
| A0A3S9MTI1 | 29-70 | None |
| R5NJ99 | 505-545 | None |
| R5NKK2 | 1-45 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.