DPCstruct | MC56362
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 150 ± 24 aa |
| Standard deviation of domain lengths | 24.33 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 40.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02605 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3RZP6 | 2-114 | QFLDNLAFYREGLKPWQRGLEIGMAHGYFLIGPFVALGPLRNTPEAATVGLLCGIAIVGMVTAGGLLFGSTIKPTRFDKSGDKPAGG… |
| U5QP88 | 11-138 | DPQEGTLLTPINNSQAVRWFIDNLPINRQGMDEFTRGLEIGLAHGYWLLGPFALLGPLRNTELGLVAGLLSAISLVLISTIGLSGYA… |
| A0A3N6PHH4 | 777-916 | None |
| A0A812T6A5 | 220-354 | None |
| A0A7J0FL60 | 62-212 | None |
| A0A0E0MLT5 | 182-336 | None |
| A0A7X6HPQ2 | 114-249 | None |
| A0A0G4GX71 | 46-249 | None |
| A0A2J8AD16 | 112-268 | None |
| A0A0D9XYU8 | 263-418 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.