DPCstruct | MC5636
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 155 ± 11 aa |
| Standard deviation of domain lengths | 11.19 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G1IHU0 | 355-491 | QYVPSLMNWGELRVFLSTRMSAAGTREPYIIHVIRTQQRDKGIHAWNVTEWDRWPEFPMLTFQQLEDFSVEVFQQLQHFNPMYYESL… |
| A0A093YMD2 | 731-882 | HQELVPTFADWGEFRVFIVTKPEPHSRRGLGGMIVAVAHTVNSTTDNDTMYVERATNATFTRINCGLCLDDLKHFAMNTFNSLRARH… |
| A0A834VRA3 | 603-768 | None |
| J4KL54 | 580-746 | None |
| A0A0F7ZI93 | 816-962 | None |
| A0A317AKM7 | 410-575 | None |
| A0A2N6NJX7 | 235-372 | None |
| A0A162MVE1 | 405-565 | None |
| A0A0I9Y620 | 309-464 | None |
| T0K8A9 | 161-304 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.