DPCstruct | MC56358
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 508 ± 50 aa |
| Standard deviation of domain lengths | 50.19 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 17.07 |
| Pfam Score | 95.83 |
| Assigned Pfam label(s) | CL0020- CL0004 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B6BUM9 | 9-519 | PEDGLYEDITLDEFDPETQTKKEELKKAKQEEMLNELEFKNLNLEQREVCRVRRKLLQYLYRLKTYECILGGVHAAAERFNEKFFQK… |
| A0A842ZBU0 | 1-500 | MNTIISPPKLVLLAAHLTSQGDIDSLSFLVSRHSETLRRDLVLRILLTYLPETVHSHAYVPFLQELASGDFADYDPVDIDDTTVASL… |
| Q9FIN7 | 512-1041 | None |
| A0A0M8MVR7 | 87-634 | None |
| A0A6A5QTS3 | 250-770 | None |
| A0A453PQ70 | 528-1031 | None |
| A0A060SH44 | 90-670 | None |
| D8M8S6 | 50-536 | None |
| A0A4V1J347 | 9-539 | None |
| A0A183W6V0 | 768-1191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.