DPCstruct | MC56355
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 293 ± 48 aa |
| Standard deviation of domain lengths | 48.23 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 74.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 20.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B6CQA8 | 1-321 | MDDELDYGPFDGEIPERLEEDARIKGSSRNLSKARLCPVCPGRFTNVRRHVFHQHLPWYTNPLTACWTCHKQFGQNKMLENHCLELH… |
| A0A8B6BPR6 | 1-294 | MDIPTLQQCPIQGCPIRALDIQPHVMLEHVAEVFGEQRDQPRASLAPIRVAALQAQAWMLVGGDLEDLVTHVNRLEITRPHIIGQAV… |
| A0A8B6CDT3 | 1-354 | None |
| K1RC34 | 6-330 | None |
| A0A6J8B0C6 | 5-213 | None |
| A0A6J8DP14 | 18-273 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.