DPCstruct | MC56351
Metacluster Properties and Pfam Annotations
| Number of structural domains | 181 |
|---|---|
| Mean domain length (aa) | 131 ± 25 aa |
| Standard deviation of domain lengths | 24.53 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 80.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 27.56 |
| Pfam Score | 99.59 |
| Assigned Pfam label(s) | CL0629- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q7N097 | 14-144 | LPEARSSLLNLKSMVEGITGRNAILSFVGYGCYCGLGGHGLPMDEVDWCCHAHDCCYQKLFDLGCHPYVDHYEHTIENNTSVICSEL… |
| A0A8B6BL73 | 22-160 | EGLRVKRDLFQLAEMIVDATGRDPLNFNGYGCYCGWGGSGTPVDKDDRCCQQHDDCYGQVTTDLPDCSPKWNHYAWKIQDKTVDCLD… |
| A0A803KFH5 | 53-185 | None |
| A0A1S3J4P2 | 15-100 | None |
| A0A1S3IAI9 | 197-325 | None |
| E4Y8M7 | 57-208 | None |
| H0ZT62 | 102-243 | None |
| A0A2R9B0B2 | 73-205 | None |
| A0A6J0C6E6 | 88-209 | None |
| A0A818TTW7 | 28-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.