DPCstruct | MC5635
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 213 ± 22 aa |
| Standard deviation of domain lengths | 21.95 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 20.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A428R2M2 | 19-252 | GFSLSAGRFMVTKGNVVRANGSRLRALFNPTSLRLRQDQEKAEKAAEALSDKVFVAGQLKHYGIKFPRTTELGFIRDILRRAVEQGK… |
| A0A397HI43 | 12-205 | EPLKSGVFTYDKDGIKAGGFTRASFGELRLLFRKNASSARVRSATKPWVTAQLRLYGIPFHTQASAAQLKAALETALETAVKNRQCL… |
| A0A1E3B9H7 | 15-204 | None |
| A0A066XLU3 | 2-190 | None |
| A0A0C3BU01 | 16-258 | None |
| A0A0C3BFK4 | 1-225 | None |
| A0A6A6Z626 | 1-234 | None |
| A0A1L9V4S3 | 1-216 | None |
| A0A318Y833 | 2-214 | None |
| A0A4Z0YU75 | 432-633 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.