DPCstruct | MC56348
Metacluster Properties and Pfam Annotations
| Number of structural domains | 486 |
|---|---|
| Mean domain length (aa) | 141 ± 32 aa |
| Standard deviation of domain lengths | 32.19 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 75.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 17.64 |
| Pfam Score | 68.10 |
| Assigned Pfam label(s) | PF05461- CL0236- CL0124- CL0219- PF04434 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B6BFQ6 | 13-157 | DLSHLPDISFAFVEEFIRKHSQSSGKEQMTKGFKYYSEEYVHSVSVHPDDTGCLVKGKCFRSQRKNESPHDVKIMLNGVQIEYSFCT… |
| A0A1J1EHY4 | 6-105 | PEREEDFAPLLPEEVARRGLAYAREGRVRRVFRVGERLLGEVQGSEPTPYRVEVGPGLVGRCTCPYPFFPCKHAAALLYAYLERRPE… |
| A0A2E8K2H1 | 31-122 | None |
| A0A7V2T4H9 | 312-394 | None |
| A0A2N2CAP5 | 1-109 | None |
| A0A6P8HNX7 | 111-229 | None |
| A0A2G8LL54 | 51-255 | None |
| F4KPQ9 | 5-89 | None |
| A0A7R9A9E8 | 8-121 | None |
| A0A6G7Y553 | 1-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.