DPCstruct | MC56339
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 198 ± 27 aa |
| Standard deviation of domain lengths | 26.74 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 24.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S8V322 | 2-177 | TMNAETTITLAKGAHSNPEEGMCLLEAASFVAGEAFSDTPQCVSPVLGSFGRALNDALPTDKRQELVPLIPRIIGTRGDGKDERRSY… |
| A0A800BF01 | 1-171 | MCAMEMVAWLAGEAHNDEPECACPVVSALVRACNDAMSDPSRKRYLRPLVPQLVHTRANATVERLRGLLAIDCLVRRLLPRWLERHH… |
| A0A4R5QD22 | 47-230 | None |
| A0A538KP20 | 1-164 | None |
| D3PVH7 | 1-186 | None |
| A0A369TAU1 | 12-227 | None |
| A0A7W0QA12 | 13-248 | None |
| A0A021X467 | 5-202 | None |
| A0A7Y9IPN6 | 9-172 | None |
| A0A317KAQ3 | 1-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.