DPCstruct | MC56338
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 176 ± 25 aa |
| Standard deviation of domain lengths | 25.11 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 19.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S8UNT0 | 31-204 | TVGDIPEFEGPWSDLFANVYSSTTTTEVQREILADGVITDAEYAQLRGDFKQCLEDLGLTVEIYPSGGFAVDENGSVNETQISEDAV… |
| A0A852T456 | 1-123 | MSEQQRSELADSHVTYDEYQAAFTRFVVCLEAGGFVVEKVGESNQVIDYRIPEAASKGGTSSRCYDREFRQVDARWQVSREDTSAQA… |
| A0A3A3Z0G8 | 47-220 | None |
| A0A3B0T1A2 | 29-189 | None |
| A0A3B0SYK5 | 27-200 | None |
| A0A087AK77 | 8-186 | None |
| A0A4P6F999 | 8-189 | None |
| A0A5M9ZHJ8 | 13-180 | None |
| A0A853CZU4 | 1-179 | None |
| A0A415C5V2 | 3-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.