DPCstruct | MC56333
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 86 ± 13 aa |
| Standard deviation of domain lengths | 12.83 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 62.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08045 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E0A4G1 | 1-75 | MKITSPPTDNEIALALRVLEGCCLLYSRCTALAHKYKAVKVILNILANRGPAEQGVCLDALISLMLDSPPNQMDF |
| A0A7I8J9I6 | 88-178 | LKINSPATDSEMALALRVLEGCCLIHRQSRDLAQHHNGIKVLVNILSTRGALEQGACLDAFLSLMVDSSANQREFEISGGYETVVEC… |
| K3XZ28 | 130-224 | None |
| J3N466 | 37-132 | None |
| A0A5N5F3R3 | 29-102 | None |
| A0A0A9CWN7 | 1-75 | None |
| A0A453QIR9 | 72-146 | None |
| A0A1Z5S983 | 1-113 | None |
| A0A1Z5S8Y6 | 7-80 | None |
| A0A6G1F0Q8 | 89-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.