DPCstruct | MC5633
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 62 ± 4 aa |
| Standard deviation of domain lengths | 4.05 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 55.49 |
| Pfam Score | 96.15 |
| Assigned Pfam label(s) | CL0129- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M5CBE4 | 57-120 | CTLAEHNSWPSAPITTPIIGLKELPVSTDPLPHTHIQFAHCYKRQGGWADVLARFYHGGGTLYD |
| A0A428QSC5 | 1-67 | MPAGSWVNAPTDGVILGLKEIQVDGTPLPHTYIHFAHVFKKQHGWATELSRFSKAGGLLYDLGVSHR |
| A0A093Y9F8 | 435-497 | None |
| A0A2P6N1D9 | 304-360 | None |
| A0A1C7MSZ6 | 1-70 | None |
| A0A3M6UD01 | 101-161 | None |
| A9UYX5 | 187-250 | None |
| A0A2B4RQC6 | 229-285 | None |
| A0A135S1R0 | 336-396 | None |
| A0A395H2S8 | 59-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.