DPCstruct | MC56327
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 117 ± 11 aa |
| Standard deviation of domain lengths | 11.20 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 32.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G1J043 | 70-173 | RVICTHFYRKGLLPQNVWRADMKFTASHLSETTVRGYHFWAIPYVELMRKSTLAESIMFPVAKWRAEELAYQMGELPSSNFKGKIVR… |
| A0A345DCW5 | 3-99 | DQTVWRADMAFTFKNLSPTTVRGYHVWAIPYVCLMRKSQLAEKLMFPIAKYRAQELAYQMGVVEKGSWRGKLIRLVLEPICWALGVF… |
| A0A2E2QJE3 | 201-329 | None |
| A0A2D9CHL5 | 305-405 | None |
| A0A4R1YMI1 | 62-175 | None |
| A0A0F9RQ59 | 217-349 | None |
| A0A2M8U7E5 | 484-613 | None |
| A0A351RD37 | 56-185 | None |
| A0A1X7SDF8 | 105-231 | None |
| Q2L0Z1 | 9-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.