DPCstruct | MC56325
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 99 ± 6 aa |
| Standard deviation of domain lengths | 5.83 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 29.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A554IWI1 | 7-104 | CTCYAEILNKIIFCIHPMTEAEIAMCITQALSNLYKDDFGLIRVEAEEESISAHLTNYLKPYFKTWNVDIEYNRDGQVTKKNSGGDS… |
| A0A441X368 | 1-88 | MDQDALERILNTALDKLYAGDQAIIKVDVAERTICARLAAILQASFKDHAVHAEYNRHGVDPKEISLPNADGVLTGTRVFPDIIVHQP |
| A0A3S0KMJ8 | 1-97 | None |
| A0A7Y3NS65 | 24-124 | None |
| A0A7X8R8Z6 | 6-111 | None |
| A0A7M1T811 | 1-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.