DPCstruct | MC56322
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 87 ± 11 aa |
| Standard deviation of domain lengths | 11.32 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I3DXZ9 | 1-78 | MKPTVGRIVYYKSYGTPNGEYKSEERAAIVTGVVDDETVHLCVLNPTGMFFNLNVKQGQNGGQRDWMPYQKGQAQKTD |
| A0A7Y4R498 | 2-75 | PEISIGRVVIYKTTEDDRKSLKGAYGNQSTELPAVVVAVWNSTLVNLKVITDAPVDIWKTSISQGDNEGQWNWP |
| A0A210W809 | 5-101 | None |
| A0A4V0HTY3 | 2-95 | None |
| A0A839E9G5 | 25-100 | None |
| A0A5M3WEM3 | 5-88 | None |
| A0A2N3RR10 | 72-145 | None |
| I0H2S5 | 29-118 | None |
| A0A7T7YTR0 | 1-89 | None |
| A0A2Z3GUZ2 | 40-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.