DPCstruct | MC5632
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 85 ± 13 aa |
| Standard deviation of domain lengths | 13.37 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V6L6C1 | 2-60 | YRVYFWDTTSNHSHEYQVSEADIDEVLVWARREADAHGWSYTIYVKVSDEGQPGLVRLC |
| A0A516GDM2 | 1-96 | MRVFSVDERDSSWELPAPRFRVYLHGSERDATYGWTATYDILDADVLQAIDWAQRQAGDQRTYAVALVYDDATHERLNPGHGRGLVW… |
| A0A2S3ZR34 | 27-118 | None |
| A0A1Q8LKA4 | 1-83 | None |
| A0A3L6ZJC4 | 1-98 | None |
| A0A4Y4DS38 | 1-86 | None |
| A0A2N7RYA7 | 2-58 | None |
| A0A2S9D574 | 1-70 | None |
| A0A6G7Y7D0 | 1-80 | None |
| A0A7X9GT00 | 1-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.