DPCstruct | MC56319
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 118 ± 23 aa |
| Standard deviation of domain lengths | 23.40 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 81.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 47.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M3FR84 | 1-138 | LVPETNEPKVDPEYQQTLDTLLQRVKESKTPAEVNAVYRYTRKWDDEQMKPILLATHKRLEELEKEQASANEPPSLMVQIQNAPDLT… |
| A0A6I2ACA4 | 78-184 | QRVKESKTPEEVNAVYRYTRTWNDKQMEPLLLATHKRLEELEKSKVPANEPPSLMVQIQNAPDITTLDALEIDVAARDPQIQSRLMD… |
| A0A1T1GW44 | 187-287 | None |
| A0A833UDN4 | 1-106 | None |
| A0A4V2DPI2 | 72-179 | None |
| N9PN05 | 275-374 | None |
| A0A6P1SU35 | 138-297 | None |
| N9MQY1 | 232-330 | None |
| A0A7S6VV65 | 369-474 | None |
| A0A653LBV8 | 2-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.