DPCstruct | MC56315
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 82 ± 11 aa |
| Standard deviation of domain lengths | 11.18 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 94.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 41.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7E4S016 | 59-142 | KLMAFDIKMLVIACNTATAVALKHLQNILPIPVIGVIEPGARTAIMTTKNNDVLILGTEGTIKSEAYRHHIKNINPNVEVSGIA |
| A0A0B0IBC8 | 61-129 | FLSQFNPKAIVIACNTATAAALEYISEKVPIPVIGVIHPGARAAISATKTGHIGVIGTTGTIRSGAYTA |
| A0A2N1VT72 | 45-136 | None |
| A0A4Q7N6B2 | 163-250 | None |
| A0A6G3VC75 | 50-110 | None |
| A0A2Z5R046 | 60-146 | None |
| I5BTF9 | 165-256 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.