DPCstruct | MC5631
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 70 ± 8 aa |
| Standard deviation of domain lengths | 7.87 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 32.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E4KRZ9 | 11-77 | KCYLCAKMGKDVDAVAACIVCGMGVCMEHAIYEATPVWKGDYPVRLEKDIENMRRILCQPCHEALKE |
| A0A516G9H4 | 1-79 | MNCWDHELGGQASVRAVAVCMHCGAGVCLEHASVRETERYRQNGVGSPSRLLPNSREISCAACAEASMNGSRTAVPGSR |
| A0A5B2WK66 | 129-212 | None |
| A0A2U3A0B6 | 82-151 | None |
| A0A5N8VAJ5 | 35-102 | None |
| A0A2S4ZC07 | 1-72 | None |
| A0A8B2DVI2 | 20-86 | None |
| A0A7W9MY77 | 1-81 | None |
| A0A7Y8LGD6 | 3-57 | None |
| A0A7K2G574 | 1-67 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.