DPCstruct | MC56308
Metacluster Properties and Pfam Annotations
| Number of structural domains | 75 |
|---|---|
| Mean domain length (aa) | 130 ± 36 aa |
| Standard deviation of domain lengths | 35.70 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 68.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 24.91 |
| Pfam Score | 63.40 |
| Assigned Pfam label(s) | PF02158- CL0001 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B1JA97 | 12-152 | HAVSALATVLLLFSTTAEPAEPSNSTHMPELFTHNEEPRVLALQRVPCGAQHESYCINGTCSYINDLTMPQCKCDPNFSGPRCEHFI… |
| A0A663MS24 | 6-86 | FCIHGECIYLEHLQMVTCKCHQDFFGERCGEQFMKTQRKNDVADYSKTVLVVVAVLLSSISFITVVIIVIVQVRKKCPQYE |
| A0A4W3K888 | 49-178 | None |
| A0A803JN16 | 118-232 | None |
| A0A4Z2HP66 | 33-149 | None |
| A0A091VES5 | 11-104 | None |
| A0A0G2JDT8 | 427-531 | None |
| A0A553MMM2 | 64-177 | None |
| A0A835NR93 | 7-111 | None |
| A0A267FXN6 | 4-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.