DPCstruct | MC56303
Metacluster Properties and Pfam Annotations
| Number of structural domains | 69 |
|---|---|
| Mean domain length (aa) | 330 ± 79 aa |
| Standard deviation of domain lengths | 79.12 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 77.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05024 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L7WXH9 | 761-1126 | AGTLDWSERCPPKVLLRYRIAHIIILDFSGGGPLWGLASYFYTTLRRRKDDWESFTDSHLEYIRLSNALWLILNDIIIGIALGSWIL… |
| E2ABX6 | 24-279 | FFLLYPVLWLSTITKKLLPVLKYSSLGLHVYNWLENIKWMLITILHDKNFKLKTANYASAIVVDIALGIFVLRLLQYYIEDQPSQLL… |
| A0A6V7PXI8 | 308-733 | None |
| A0A067RQR3 | 2-225 | None |
| A0A7M5VGI4 | 20-272 | None |
| A0A151LPB4 | 351-729 | None |
| A0A4U6U7K5 | 3-370 | None |
| B9IHV3 | 98-303 | None |
| A0A507FHD1 | 609-1038 | None |
| A0A8A3P416 | 131-510 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.