DPCstruct | MC56302
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 172 ± 16 aa |
| Standard deviation of domain lengths | 15.57 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 26.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14027 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L7WM71 | 26-201 | AQSIDLPSVEIHDVETAPEKRPRTLKHLLRANHVNHSIIYHDLQYHNHMPHLLGSAYLLGANVDQLQKIYDEESKELEDWKDSPAEI… |
| A0A2A9P2M4 | 7-189 | FDISAGETGLLKVKQDDAAASRVTELLQKDLENHHVFFNNEGFHNHMAHQLLTLYGTGSTAEGLSQAYEQNQSYQRPAQQADVSIVD… |
| A0A319DG36 | 92-274 | None |
| A0A3F2RDF3 | 137-293 | None |
| V2X6W5 | 126-297 | None |
| A0A0W4ZWI4 | 20-170 | None |
| A0A1I3GCJ8 | 4-182 | None |
| R1GA07 | 23-184 | None |
| A0A1L9TRH6 | 216-387 | None |
| A0A0C3C5L3 | 29-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.