DPCstruct | MC56300
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 131 ± 15 aa |
| Standard deviation of domain lengths | 15.27 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L7X2V9 | 2-134 | NSSIYTESNKAQSTVVAHRKPQDKVSKSNTTQTTTLCTLTPEVHLLIFDHLNFADSTLLGLTNKNFYKIHRGKHGKVPLTSKSESIG… |
| A0A1L7WC34 | 27-173 | LATTAATSTALVRVRPTASRVFDTSSKKSDRDHETYPASKATETVDVPITLQTLPYDVQFAILKHLDPVSSTCVGLTCQGLYKVHRR… |
| A0A2J6TT14 | 283-409 | None |
| A0A2T3BDS4 | 2-138 | None |
| A0A2T3B830 | 79-231 | None |
| A0A1L7X2U9 | 27-171 | None |
| A0A2J6TC88 | 1-102 | None |
| A0A2J6SA89 | 25-173 | None |
| A0A194XHQ4 | 31-162 | None |
| A0A194XFY7 | 27-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.