DPCstruct | MC5630
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 391 ± 72 aa |
| Standard deviation of domain lengths | 71.52 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 66.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 28.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A388K337 | 166-518 | MPGRMEGRLPGPYTDENKGQRTLYHCIYARDGPKGSTVSWKDLCPTYFKNFGDMTCREREVALLLLISGKVVATKVRVTPPRVNTEC… |
| A0A388MET4 | 116-453 | MSGRMEGRLPVPYTDENKGQRTLYHCIYARDGPNGSTVFWKDLCPTYFKNFGDMTCREREVVLLLLMSGKVVATKVRVTPPRVNTEC… |
| A0A388LKE4 | 392-888 | None |
| A0A388L6D8 | 1-398 | None |
| A0A388L418 | 306-655 | None |
| A0A388L1D6 | 3-512 | None |
| A0A388KSX7 | 484-998 | None |
| A0A388KNZ9 | 137-520 | None |
| A0A388KMM7 | 70-420 | None |
| A0A388KGH1 | 210-701 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.