DPCstruct | MC563
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 117 ± 6 aa |
| Standard deviation of domain lengths | 6.08 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 61.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N0K738 | 1-104 | MEITRFEEKLNKVDGNIYVIEEKVQLSDGVYNGELKHDNINPTTLAIYTGPRLTGDRIQTFSLSTPSLTPWKRIIKIFADVVEVYIS… |
| A0A1R1A0I7 | 1-120 | MRYPAEVDQFTVKLNKKEGSELYVIEEQLAVLGGVFEGDLAHDDIRKESIQVYTGPGLSGEKIQNYFLTVPAETPWRLRIKLFAQAE… |
| A0A413LCG2 | 2-119 | None |
| A0A1C5TGV1 | 2-119 | None |
| A0A395YGL8 | 3-120 | None |
| A0A3E3IA46 | 1-121 | None |
| A0A2N0K390 | 1-104 | None |
| A0A413W4H9 | 2-119 | None |
| A0A174KVG7 | 2-119 | None |
| K6SYF0 | 3-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.