DPCstruct | MC56299
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 116 ± 13 aa |
| Standard deviation of domain lengths | 12.94 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 75.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 21.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J4V7T7 | 1-113 | MNKDPKKIVEQIFSLVTELAEMTGHKISALQSSNKPLPKAKTSGTTGGIRGLVDEGYLDDPKLLPEIIERLKQEGRHYSNAAVSMGL… |
| A0A2E9QSG1 | 86-191 | KRGAKSAKSVKTAKSKAKPKAKPKKSSKTTSQTSNMTSGEAIEMLDAENYFVSKRTIPEIREELAKRGHEFQGRQLFPVLISYTNKK… |
| A0A497MTY2 | 22-127 | None |
| A0A7C4CQP2 | 553-676 | None |
| A0A5E4JFW3 | 14-116 | None |
| A0A7C5MJH1 | 21-137 | None |
| A0A497YR26 | 1-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.