DPCstruct | MC56294
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 214 ± 20 aa |
| Standard deviation of domain lengths | 19.83 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 43.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I0KJJ0 | 1-216 | MRAKFNETAAWEYAQSMDGQPYGYHNMIFSWIDTIDGNYPPPLDAHLVASVMTVWNQIQPAYAANLWNEALNKRLGTQGLDLPDILV… |
| J9HNY1 | 161-344 | VQKNKYEDWLDLANAADYDVAWIQMKEQLRNSTFNLTSAWEFYNDTEGRPYGHGQQIYSIIDTVDKNYPLPFQKENVAMIIKYLYEL… |
| A0A7S0YUG5 | 307-525 | None |
| A0A813A273 | 681-899 | None |
| A0A4S4DKG0 | 133-376 | None |
| M7YRX8 | 259-493 | None |
| A0A830CIR2 | 197-386 | None |
| A0A2I0JIX2 | 1-186 | None |
| A0A2P5X5U0 | 857-1035 | None |
| A0A2U1N000 | 320-507 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.