DPCstruct | MC5629
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 215 ± 24 aa |
| Standard deviation of domain lengths | 23.72 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 48.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P8HCK4 | 388-601 | VMFCLDNVEKLCSSTSVFTKYFPNLFKILAWSPRTFLREFMQLLPVMMSEDTVVEVFHSILDLPCLSASVCASWAARGRISNNSDSQ… |
| A0A388MEC7 | 4-238 | PLLFKVLAWGGSELDSAFEELLPRLLVPSSFIPLFHAILDLPALVLALEDFERGSGYRPGMAPAGTVKSPAPEALLALMDVAYTGSI… |
| A0A086QTV0 | 4-236 | None |
| A0A5A7REQ1 | 149-380 | None |
| A0A6A2YNT9 | 1-164 | None |
| B7ZXH3 | 1-220 | None |
| A0A1R3KAH3 | 123-359 | None |
| A0A0A9DN92 | 1-196 | None |
| A0A0D2Q2R1 | 152-380 | None |
| A0A443PRP8 | 1-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.