DPCstruct | MC56287
Metacluster Properties and Pfam Annotations
| Number of structural domains | 76 |
|---|---|
| Mean domain length (aa) | 376 ± 92 aa |
| Standard deviation of domain lengths | 91.61 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 84.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 20.84 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | CL0137- CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S8L6R7 | 2-270 | YPKLVALDTDWTLFWGWLDQNTWGKGPGAFSPVEDNIEKSGYWEVIDRSNPNNKCGMYADVPRIIQDILKNGAQIAIVSRNTSKPMC… |
| A0A853FUM1 | 73-470 | TDKVLDALSSCPAALAQQALDLLVTALPEGALETPAELDDAMAFCIAILAGASGQRDAVAVFLDQARPGRAEGFYGPPAARIAAHFA… |
| A0A355ETG2 | 578-1006 | None |
| A0A1D8TPW3 | 411-895 | None |
| A0A0A0NRQ4 | 310-710 | None |
| R1BPJ7 | 22-417 | None |
| A0A1W9QEX0 | 217-752 | None |
| A0A6B1MJH7 | 2-263 | None |
| A0A6I4TYC8 | 147-445 | None |
| A0A4P7WCS4 | 4-290 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.