DPCstruct | MC56285
Metacluster Properties and Pfam Annotations
| Number of structural domains | 109 |
|---|---|
| Mean domain length (aa) | 107 ± 21 aa |
| Standard deviation of domain lengths | 20.83 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 77.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 30.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I0WNI0 | 8-104 | KREIIYPEHKSASDITSGLLHGFYHKGTFRVNSYSFPFVGYVGSESIGEEIAIFDRVNMNRAFNGDIVAVELLPQCQQTEENVNGNV… |
| A0A3P7KXU6 | 1-86 | MPYMSLEAVTRGLANGDLVKGSLRVNQRNYEESYVDNPDGDDQLDLLILGVHDRNRALHGDVVVVRIKERMNWVIRENLYQAWRAG |
| A0A3N4LZQ5 | 2-118 | None |
| A0A165R375 | 2-130 | None |
| A0A1X2GAA0 | 62-136 | None |
| A0A1X2GCW0 | 19-107 | None |
| A0A1X2GD65 | 82-167 | None |
| A0A4S4EV27 | 195-327 | None |
| A0A4S4EU69 | 300-432 | None |
| A0A162S3S0 | 69-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.