DPCstruct | MC56282
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 85 ± 9 aa |
| Standard deviation of domain lengths | 8.95 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.62 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 68.96 |
| Pfam Score | 88.41 |
| Assigned Pfam label(s) | PF16639- CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I0W7Q3 | 12-93 | GNRRRGQVYPDGSKSNNTVYNATSAGIVSIISRKEKGGYEITIVDASEGRQVVDIIPQGPELLVSEGESIKLDQPLTSNPNV |
| A0A7J7N7A5 | 55-141 | GGNRGRGQIYPDGSKSSNTIYNATTAGIVSKIILKEKGGYEITIADASDGHQVVDIIPPGLELLVSEGESIKLGQPLASNPNVGGFG |
| A0A7J7M309 | 55-141 | None |
| A0A4S4DD60 | 245-330 | None |
| T1N9X5 | 121-207 | None |
| A0A1U8FRH4 | 409-495 | None |
| A0A6P6FNM4 | 369-455 | None |
| A0A4S8I5Y7 | 726-812 | None |
| A0A4S8I6G3 | 178-255 | None |
| A0A2R6XFF3 | 84-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.