DPCstruct | MC56279
Metacluster Properties and Pfam Annotations
| Number of structural domains | 183 |
|---|---|
| Mean domain length (aa) | 207 ± 34 aa |
| Standard deviation of domain lengths | 33.53 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 72.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 20.09 |
| Pfam Score | 99.57 |
| Assigned Pfam label(s) | CL0235- CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7W1U2 | 2-150 | SRDRLKQVYKRCEANIERDKERAKIHLKEGRKSQALLLLKRKRYEETTVNTVLGYLDKITQMINSLEMAQLNVEVTERLKEGNEALK… |
| A0A2I0W0Y4 | 7-202 | SSRKQKGPSALSTLERLHETLEMLEKKEHVLQKKITAEFEKAKDYTKLKNKKAAIQCLKKKKLYEAQIEQIGNFQLRVHDQMIMLEG… |
| A0A817PD65 | 2-221 | None |
| A0A6J1WFV5 | 5-171 | None |
| A0A1X2I591 | 104-337 | None |
| A0A2C9K365 | 153-331 | None |
| A0A5P1EWT6 | 7-209 | None |
| A0A0K0DSS6 | 205-410 | None |
| A0A1V8S8S3 | 11-222 | None |
| I8A5A5 | 98-366 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.