DPCstruct | MC56276
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 499 ± 91 aa |
| Standard deviation of domain lengths | 91.36 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 12.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B8R426 | 204-793 | QKARIQIINSLLNGGCDDPNLIANTWIDNNHIRENLGKDDVIDYFSTPQPKYAITTIDNPNNPLPECNTYLNTIALEKPADLDAKLA… |
| A0A838R2K1 | 26-474 | ARLSREVVLRWTGDGSACADGSLRNTGQLVQGGATLVGQLQLQLEGLASNAREFIEGQFGGDPQAFIDSLLDETSSLDEIIRTVDRI… |
| A0A1Z4RNC1 | 3-580 | None |
| J1FE36 | 9-401 | None |
| A0A524QP34 | 20-525 | None |
| A0A2P8QUF0 | 73-460 | None |
| A0A7C2JQ81 | 46-541 | None |
| A0A257TWK1 | 377-798 | None |
| A0A8A7VAQ6 | 376-1043 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.