DPCstruct | MC5627
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 102 ± 5 aa |
| Standard deviation of domain lengths | 4.87 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 87.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 63.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N2KAP6 | 149-255 | KADIKEDYILMAEPDHIIVKPIPNLSKDGLGAAFPFFYIEPKKFESIIRKYFPEDKGPVTKIDPIGNSPVIIGKESLKKIAPTWMNV… |
| A0A388MAK1 | 1-97 | MGEPDHIFVKPLPNLASETLPAAFSFFYIEPKKFEGIVRKYYPESMGPITNIDTIGNSPVIIKKTDLMKIAPTWNNISLALKEDREA… |
| A0A5A7PAQ1 | 69-161 | None |
| A0A287FR10 | 1-97 | None |
| A0A4S4DA55 | 811-917 | None |
| A0A287VVX9 | 1-111 | None |
| A0A5J5C444 | 237-340 | None |
| A0A6A3CZE5 | 42-147 | None |
| A0A7J7FUL9 | 62-160 | None |
| A0A287FQY4 | 121-221 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.