DPCstruct | MC56266
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 461 ± 109 aa |
| Standard deviation of domain lengths | 108.92 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 78.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 14.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V4A5T5 | 60-503 | SHIMSLPVPEDNALENQERKLLAMCPEVSRINQLLDIFLNFLRPFIEEVSLKTSTSLNNDNVQAQIIVLKIHLLKILDHPVIYLDLD… |
| A0A672TY82 | 32-458 | AGQKCLEDGYAAQLLEVIQNEKNKVIIKNMGWNLISPLVRCIFMYKKDDDKREHCLKILEQLAQLCNPKELFLGLLEQIEQTSGERV… |
| A0A2A3EMB8 | 69-579 | None |
| A0A0K0E168 | 1-289 | None |
| Q5KGV3 | 2-490 | None |
| A0A6A4JLH4 | 399-901 | None |
| L7JBP5 | 81-677 | None |
| A0A162R4M2 | 97-630 | None |
| A0A7N0UU61 | 24-375 | None |
| A0A2N5VCJ7 | 1-660 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.