DPCstruct | MC56260
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 114 ± 7 aa |
| Standard deviation of domain lengths | 7.31 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 86.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 38.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V3ZL51 | 1-125 | MHTQWRDGGEWKKEKLPLTTPSDEACKMYDAVVTQYVGWYDEPSVGGIEHSVDKMIAADPDFVMGNVLKNGLDLLGTGKTVTLDPDF… |
| A0A368FT99 | 7-117 | ENLRDLEGWRASGLTLTTPSNECAKLFDGALRQIVSWSDCDALGGLVKTLEDMKAADPKAVLPRAFRLGLEGLGTSTCTRINETLKT… |
| A0A4W2HGH5 | 1-116 | None |
| A0A812EU13 | 1-123 | None |
| A0A2B4RFE8 | 7-107 | None |
| A0A815JK31 | 5-118 | None |
| S7NSQ7 | 6-121 | None |
| A0A6S7H0S4 | 5-129 | None |
| A0A0M3J035 | 45-157 | None |
| A0A183C2N4 | 9-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.