DPCstruct | MC5626
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 205 ± 23 aa |
| Standard deviation of domain lengths | 23.07 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 69.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.89 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 48.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A388MA54 | 5-204 | ETRDGTSTTPYTKEQEEEAAKILVEQKAKKEKRELVKQAKKLALLEEQAKKRKQLEEEMERLKKEEKEKLKVVEEEEEVEEEVPLVR… |
| A0A388M8S2 | 1-237 | MVDTRTGKSTAPSEAEQARIAALLKEKREKKELLKQAKLNVVEEEEAAQKKRLEEEMIRFQREKLMLIEREKEERRKAAEEEAAREE… |
| A0A388KM84 | 1-231 | None |
| A0A388KPF8 | 1-192 | None |
| A0A388KQD8 | 3-199 | None |
| A0A388KTF5 | 1-206 | None |
| A0A388L256 | 148-381 | None |
| A0A388L4J7 | 17-228 | None |
| A0A388KAA2 | 2-220 | None |
| A0A388LB44 | 1-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.