DPCstruct | MC5625
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 338 ± 29 aa |
| Standard deviation of domain lengths | 28.57 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 66.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 31.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A388MDX3 | 79-433 | LEYTVQYVTHEVSSKAYPCDFHHVVVEPVYDPNKDIFFKLTSKKRRQVYSFLYGEQPRLRFDPQYVVRKEVAIAVLQGYHGASRAGA… |
| A0A388M7D1 | 3-298 | FKLSERKRNKIYEFLFLETRPRRDVDAEHMRRKEHMLVLLDNYHDALRNNAKNFLDQLQCLYFVESEHVLKLKSYVALISTNDEAET… |
| A0A388KHA7 | 116-470 | None |
| A0A388L714 | 398-747 | None |
| A0A388L5C2 | 80-345 | None |
| A0A388L215 | 1-336 | None |
| A0A388KYC3 | 11-291 | None |
| A0A388KWK1 | 8-355 | None |
| A0A388KVU2 | 159-512 | None |
| A0A388KVF8 | 330-664 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.