DPCstruct | MC56233
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 104 ± 14 aa |
| Standard deviation of domain lengths | 14.14 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 67.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 36.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C6JSL5 | 1-85 | METPPRGIPLSDPCLVVNCGQGGQCEKGAGVSYQCRCQPGFKNMLDDTSMPCIGSSCTFGADCAKLGLGNTPAAPAPAPVIGNYL |
| A0A2C9VB37 | 97-187 | PKPPTEKSIPLNSSAFDPCYWTYCGGGTCTRNATYTHMCTCNSGFFNLLNISYYPCYSECTIGSDCSNLGIKVSNTQATNNTAGGAG… |
| A0A6V7NV80 | 89-185 | None |
| D8QZE1 | 76-171 | None |
| A0A4S4E5F3 | 43-142 | None |
| A0A3L6Q016 | 49-171 | None |
| A0A4D6N0V2 | 29-135 | None |
| A0A2I0X7A9 | 98-210 | None |
| A0A7J6W037 | 2-115 | None |
| A0A4D9BT09 | 119-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.