DPCstruct | MC5622
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 163 ± 19 aa |
| Standard deviation of domain lengths | 18.86 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 73.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 28.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q0CEA7 | 26-147 | SVYRPRLSKPEDPPSIWKLFHRQNQAFNFVKSCKENVHVFALECKAGDGQRIYLVTSYAQLWFYYKFRKALLHCYEVIPENAVCKLY… |
| A0A388M1Q0 | 26-210 | LSSVHLEEASEDSDNEFWNKVAIEALEELGKSSGKQQVRQEASMEDDFWGKSVVIDALEQAERCSVKQAAGEDFEHWKRFRKANDAL… |
| A0A7S3EQF4 | 1-152 | None |
| A0A0D8YDP0 | 5-184 | None |
| A0A1S3IRY2 | 1-157 | None |
| J9AT16 | 1-164 | None |
| A0A166CSF7 | 1-150 | None |
| F6H6B0 | 206-371 | None |
| A0A3R6WMV5 | 99-246 | None |
| A0A0N4XDR5 | 1-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.