DPCstruct | MC56212
Metacluster Properties and Pfam Annotations
| Number of structural domains | 80 |
|---|---|
| Mean domain length (aa) | 99 ± 14 aa |
| Standard deviation of domain lengths | 13.97 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 33.56 |
| Pfam Score | 71.94 |
| Assigned Pfam label(s) | CL0023- CL0329 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A534PYB5 | 1-95 | MEVIRIAGYTPEEKVEIARSFLIPHQLRENGLAAERLRWTRGSVLELITDYTQEAGVRGLERRVAAVCRKVARRAAEGETRPVVVNR… |
| A0A2N8FK56 | 9-86 | MEIIRLEGYTEDEKVEIAERHLIAKQIEAHGLKEGEFTLTTEGLRALIQFYTREAGVRTLEREIAKLARKALRRILEG |
| A0A2V7SVH3 | 500-597 | None |
| A0A6D2HR61 | 337-439 | None |
| A0A1F9QXY7 | 602-697 | None |
| K3WZ13 | 128-261 | None |
| A0A496SGT7 | 496-595 | None |
| A0A444WUI1 | 60-142 | None |
| A0A1E4SG18 | 772-872 | None |
| A0A0G1CS74 | 224-321 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.