DPCstruct | MC56200
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 169 ± 28 aa |
| Standard deviation of domain lengths | 28.12 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 90.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 22.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N6IXQ2 | 1-113 | MAVILLSVATGIVLMLVAGAPRTMIALIVSMLVTLAILTAITFAWKISVHQAVSAGACAMLVQTYGPWMVLGFLLVVVVGWSRVELR… |
| A0A522EVG8 | 14-181 | LWFPSNDFQLFIHSVTLLATFFLPLLSAIVMFKLKWIGSLEMKTKEERKIPYLASAVFFFTESYLLMRWDIPVLIQAMMMGSTLLIL… |
| A0A2T2UUS8 | 8-148 | None |
| A0A3R8RD04 | 7-149 | None |
| A0A6C0GJQ5 | 4-204 | None |
| A0A1F6A4M9 | 30-226 | None |
| A0A1G1V4S3 | 5-191 | None |
| A0A1V5PUJ3 | 26-203 | None |
| A0A660Y1Q4 | 12-136 | None |
| A0A315XPJ6 | 5-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.