DPCstruct | MC5620
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 95 ± 5 aa |
| Standard deviation of domain lengths | 5.09 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 82.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 62.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A388LYM9 | 1-100 | MTSAKVVLQVFENYQKSRVGFVQTVAELATKPQNIEALQSAGVMQLLRPLLLDNVPSIQQSAAIALGRLANYNDDLAEAVVNNEILP… |
| A0A819G9V3 | 1-96 | MSQRHTLQVFEQYQKARLTFVQSVADLATRPQNIETLQNAGVMALLRPLLLDVVPSVQQTAALALGRLANYSDHLAESVVRGDILPQ… |
| E9AIJ7 | 144-240 | None |
| A0A455B816 | 820-912 | None |
| A0A2K1J2H0 | 15-96 | None |
| A0A812QPJ8 | 1-97 | None |
| A0A813HME9 | 1-92 | None |
| A0A7J6YTU5 | 1-96 | None |
| A0A060XW46 | 1-97 | None |
| A0A4U5VI44 | 78-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.