DPCstruct | MC56193
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 224 ± 29 aa |
| Standard deviation of domain lengths | 28.69 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 17.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A542FVA7 | 67-312 | GRTGIDLLLERGKLRVDELVALARELFASGAVAHEPIPGTETARVHIGAKPDAAWAFLAMEATHNVRCALDQLAWRLVEIDGGTPGR… |
| A0A7Z6RRM8 | 28-261 | QAGDLLFTYQVESGNVIELREQSDGLVNQLIVESLLPIPRKLTLVVADAMVALRGVLEHTLFAEIEHRDGLLGDEWARLVEMPATLN… |
| A0A2L0QZD7 | 14-206 | None |
| A0A1X7KSB4 | 13-248 | None |
| A0A1M5HBK8 | 9-229 | None |
| A0A7T9CK11 | 8-207 | None |
| A0A286EJW8 | 67-329 | None |
| A0A4Q1UIK7 | 6-202 | None |
| A0A6P1YNQ0 | 2-188 | None |
| U5NZH3 | 9-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.