DPCstruct | MC5619
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 194 ± 38 aa |
| Standard deviation of domain lengths | 38.14 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 72.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 46.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A388MF74 | 383-508 | WVDCDAFWNQGLGKPLREAVGECINYFVAVANGDAGAEPPSMLIMPPNDVPRFKIDDPAQREPALRRARSVERVVLRTIHGWIFKSR… |
| A0A388LYB4 | 10-222 | DDLRFWNEREGFAIVKLIVEARGYLVVVVRGEQPPPIRRSIVFPHNNIPQQKIPDESEFNVAKERVVKVQGIALRVIHGWVFKSQNK… |
| A0A388LFU4 | 1076-1238 | None |
| A0A388LCY9 | 32-251 | None |
| A0A388JZ30 | 520-715 | None |
| A0A388KN47 | 86-246 | None |
| A0A388KKZ2 | 283-548 | None |
| A0A388KKP9 | 803-1021 | None |
| A0A388K1P7 | 183-369 | None |
| A0A388K110 | 913-1132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.