DPCstruct | MC56185
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 67 ± 10 aa |
| Standard deviation of domain lengths | 10.25 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 68.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0714 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R5SZC7 | 48-127 | MIFFLVMPFLIGGFGNWLVPLMIGTPDMAFPRMNNISFWLLPPSALLLLSSNLINPSPGTGWTVYPPLSLYSFHSSPSVD |
| A0A1Z1GBM7 | 1-55 | MPALLGGFGNWFVPILIGAPDMAFPRLNNISFWLLPPSLLLLVSSALVEVGAGTG |
| A0A4Q4NX07 | 7-61 | None |
| A0A5K7VYB7 | 92-171 | None |
| A0A7R5T607 | 49-128 | None |
| A0A4Q5NJG6 | 72-138 | None |
| A0A446TAI0 | 2-74 | None |
| A0A3Q7IH99 | 4-68 | None |
| A0A4D5RFQ3 | 23-76 | None |
| G3KEX6 | 93-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.